PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00021346-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 227aa    MW: 25461.9 Da    PI: 10.5414
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00021346-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.61.2e-12110154347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          W++eE++ ++ + ++lG+g+W+ I+  + ++Rt+ q+ s+ qk+
  WALNUT_00021346-RA 110 YWSEEEHLAFLVGLEKLGKGNWRGISTNFVTTRTPIQVASHAQKH 154
                         7******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.106101159IPR017930Myb domain
SuperFamilySSF466891.17E-14105158IPR009057Homeodomain-like
SMARTSM007175.3E-8107157IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-9110155IPR009057Homeodomain-like
TIGRFAMsTIGR015578.7E-14110158IPR006447Myb domain, plants
PfamPF002493.9E-10110154IPR001005SANT/Myb domain
CDDcd001679.35E-8111155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MARKCSCCGD MGHNLRTCIT HKMSLTGNKY FRLFGVQLDL SSSSSSSSAS SSFVMRKSFS  60
MDGLSNWFTP SSSSSSDLTT DGKFPDQCTE LISDGVVTTR NRKRKKGVQY WSEEEHLAFL  120
VGLEKLGKGN WRGISTNFVT TRTPIQVASH AQKHFLRQIK TCPNKRKRSR PSLFDVRMPK  180
FTPQIHSSST EASVDPLMES SSKITSSAVL DCRALNHRIN GRNYWPF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1101105RKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015884428.11e-49PREDICTED: uncharacterized protein LOC107420077
TrEMBLA5C1Q15e-46A5C1Q1_VITVI; Putative uncharacterized protein
TrEMBLD7TB954e-46D7TB95_VITVI; Putative uncharacterized protein
STRINGVIT_11s0016g02410.t011e-45(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32133271
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.16e-37MYB_related family protein